PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01021837001
Common NameLOC100265943, VIT_14s0030g01800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family CPP
Protein Properties Length: 830aa    MW: 91534.1 Da    PI: 5.8378
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01021837001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.96.5e-16501539240
                TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         +k+CnCkkskClk+YCeCfaag +C e C+C+dC+Nk 
  GSVIVT01021837001 501 ACKRCNCKKSKCLKLYCECFAAGLYCVEPCSCQDCFNKP 539
                        589**********************************96 PP

2TCR52.21.2e-16586625140
                TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN+ 
  GSVIVT01021837001 586 RHKRGCNCKKSSCLKKYCECFQGGVGCSISCRCEGCKNTF 625
                        589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.9E-17500541IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.939501626IPR005172CRC domain
PfamPF036382.5E-11503538IPR005172CRC domain
SMARTSM011147.5E-18586627IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.9E-12588624IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 830 aa     Download sequence    Send to blast
MDTPEKYQIA TPISKYEDSP VFNYINSLSP IKPVKSIPTD QTFSSLSFAS PSSVFTSPHI  60
NPQRESRFLR RQQFTDPSKP EFSRRDNDEN TSEGVLDAVH QLDYLDPGSS DTGITIDPSN  120
KDPKSDAGLP QSLKYDCTSP EDNRIPHNDI ETETMPEVAI RPASHVHFVQ GVSKERRQSF  180
EIETELRGIC QIGESKEAAG CDWGKLISDD TDQLIFDSSI SKEHSEVQDH KTVDPGTYSF  240
IATVLQLPHD EIDDLQKSQS MGSVDSYEQC ETEETVTKSR DVGEIKETDQ TPAVPSSTLL  300
DKLVVSDSRA EVDDKKGKKC MQSSCKLGSQ QQLSIRRRCL LYEMTGAHKK KLIYNSDSGS  360
SASSQSDGKV SSDEKQFMPF KPGNIHPSSM LAGIGLHLNA LATTAEDGNK VVKHEPLASE  420
RKPISMSRSI PSLNSMSLGQ TPLNKSLTPD LLERDLVRFD SEVQATEDAS QTSEFGVSEE  480
FNHGSPKRKR RRSEQAAENE ACKRCNCKKS KCLKLYCECF AAGLYCVEPC SCQDCFNKPV  540
HEDTVLQTRK QIESRNPLAF APKVIRSSDY VPEFGDESNK TPASARHKRG CNCKKSSCLK  600
KYCECFQGGV GCSISCRCEG CKNTFGRKDG TEEAELDEEE TEETCDKNSL DTSSQYDVVL  660
RGEEEHSDLV PPVTPSSEIS RPLVQLPFTL GGGKPPQSSL LSVGSSSQMY TSQKFGPSGF  720
ICRLPKFEKH LEMIPEDETP EILQGTLAGG VKSTSPNSKR VSPPHHKIGS TRAWRSGRKL  780
ILRSIPSFPS LNPCQESSDR SPGKTQHLCC VHPNRASVLV ESQGSSNLD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1486491KRKRRR
2487491RKRRR
3487492RKRRRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.154530.0bud| fruit| inflorescence
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4866290.0AM486629.1 Vitis vinifera contig VV78X015144.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010659899.10.0PREDICTED: CRC domain-containing protein TSO1 isoform X1
TrEMBLF6HTT30.0F6HTT3_VITVI; Putative uncharacterized protein
STRINGVIT_14s0030g01800.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-110Tesmin/TSO1-like CXC domain-containing protein